PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538690.1_FGP013
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 703aa    MW: 78698.7 Da    PI: 6.5124
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538690.1_FGP013genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS389.34.3e-1193276962374
               GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                        ++lL++cA+ v+++d + a++lL++++++a  +gd  qRla++f+++L+arla+++s++yk+ + ++ +    +++l+a++l+  ++P+ k+
  KN538690.1_FGP013 327 ETLLIHCAQSVATDDRRSATELLKQVRQHAHANGDGDQRLAHCFANGLEARLAGTGSQIYKTYTITRLP---CTDVLKAYQLYLAACPFKKI 415
                        789**************************************************************9999...9******************* PP

               GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlva 183
                        sh  aNq+Il+ave++++vHi+D++i +G+QWp+L+q L++Rp+gpp+lRiTg++ p++g   +e++eetg+ L+++A++++vpfef++ +a
  KN538690.1_FGP013 416 SHYFANQTILNAVEKAKKVHIVDYGIYYGFQWPCLIQRLSNRPGGPPKLRITGIDTPQPGfrPAERTEETGRYLSDYAQTFNVPFEFQA-IA 506
                        *****************************************************************************************.7* PP

               GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleakl 275
                        +r+e++++e+L+++++E+l+Vn++++ ++l+desv  es+r+  Lk++++++P+v+++   + ++n++ F++rf eal +ysa+fd+le+++
  KN538690.1_FGP013 507 SRFEAVRMEDLHIEEDEVLIVNCMFKFKNLMDESVVAESPRNMALKTIRKMNPHVFIHGVVNGSYNAPFFVTRFREALFHYSAIFDMLETNI 598
                        ******************************************************************************************** PP

               GRAS 276 preseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpL 367
                        p+++e+r  +E +l++re+ nv++ceg er er et+++W+ r ++aGFk++pl+++++k a+  +r +++d + ++e++ +l++gWk+r L
  KN538690.1_FGP013 599 PKDNEQRLLIESALFSREAINVISCEGLERMERPETYKQWQVRNQRAGFKQLPLNQDMMKRAREKVRCYHKD-FIIDEDNRWLLQGWKGRIL 689
                        **********************************************************************77.******************* PP

               GRAS 368 vsvSaWr 374
                        +++S W+
  KN538690.1_FGP013 690 FALSTWK 696
                        ******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.504300677IPR005202Transcription factor GRAS
PfamPF035141.5E-116327696IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 703 aa     Download sequence    Send to blast
MAEDIDEKFE HYPVNADDLL AAEKPFLEIL ADQSPYSGGS SVESPDGSSA ANSCNSLSPC  60
NCSSSSDGLG AVPQTPVLEF PTAAFSQTPQ LYGDLIPTGG MVESGGAWPY DPTEFYQLQT  120
KPVRENLLSQ SSSFASSNGS SVTFSEGFES LLSPAGVLPD VSLNDFVVQN QQALQFRRGF  180
QEASKFLPDE SKLVIDVDKL YSGDEGSRFL GEVRQEKKLV KVKTETSDVE AAGHRGKKHF  240
YGDDLDAEEG RCSKHSAQGI DTDHLVRDLM DKVLLCNGET CSKGVKELRE ALQHDVAKHS  300
GGGHGKGSSH GKGRGKKQPK KEVVDLETLL IHCAQSVATD DRRSATELLK QVRQHAHANG  360
DGDQRLAHCF ANGLEARLAG TGSQIYKTYT ITRLPCTDVL KAYQLYLAAC PFKKISHYFA  420
NQTILNAVEK AKKVHIVDYG IYYGFQWPCL IQRLSNRPGG PPKLRITGID TPQPGFRPAE  480
RTEETGRYLS DYAQTFNVPF EFQAIASRFE AVRMEDLHIE EDEVLIVNCM FKFKNLMDES  540
VVAESPRNMA LKTIRKMNPH VFIHGVVNGS YNAPFFVTRF REALFHYSAI FDMLETNIPK  600
DNEQRLLIES ALFSREAINV ISCEGLERME RPETYKQWQV RNQRAGFKQL PLNQDMMKRA  660
REKVRCYHKD FIIDEDNRWL LQGWKGRILF ALSTWKPDNR SSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-523306968375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0032400.0AP003240.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0406G08.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015619294.10.0PREDICTED: scarecrow-like protein 9 isoform X1
SwissprotO809331e-178SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0E0N4T10.0A0A0E0N4T1_ORYRU; Uncharacterized protein
TrEMBLQ5N9X30.0Q5N9X3_ORYSJ; Os01g0842200 protein
STRINGLOC_Os01g62460.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP125183137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-178GRAS family protein